missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KANK3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | KANK3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KANK3 Polyclonal specifically detects KANK3 in Human samples. It is validated for Western Blot.Specifications
| KANK3 | |
| Polyclonal | |
| Rabbit | |
| Q6NY19-2 | |
| 256949 | |
| Synthetic peptides corresponding to ANKRD47 The peptide sequence was selected from the N terminal of ANKRD47. Peptide sequence GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ANKRD47, ankyrin repeat domain 47, Ankyrin repeat domain-containing protein 47, FLJ46061, kidney ankyrin repeat-containing protein 3, KN motif and ankyrin repeat domain-containing protein 3, KN motif and ankyrin repeat domains 3 | |
| KANK3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title