missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KANK3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56366
This item is not returnable.
View return policy
Description
KANK3 Polyclonal specifically detects KANK3 in Human samples. It is validated for Western Blot.
Specifications
| KANK3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ANKRD47, ankyrin repeat domain 47, Ankyrin repeat domain-containing protein 47, FLJ46061, kidney ankyrin repeat-containing protein 3, KN motif and ankyrin repeat domain-containing protein 3, KN motif and ankyrin repeat domains 3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 256949 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q6NY19-2 | |
| KANK3 | |
| Synthetic peptides corresponding to ANKRD47 The peptide sequence was selected from the N terminal of ANKRD47. Peptide sequence GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Streptomyces sp. C: 91%; Chlamydomonas smithii: 83%; Streptomyces sp. SPB74: 83%; Streptomyces sp. Mg1: 83%; Florida lancelet: 76%; Rhodobacterales bacterium Y4I: 75%;. | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction