missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ISYNA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ISYNA1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ISYNA1 Polyclonal specifically detects ISYNA1 in Human samples. It is validated for Western Blot.Specifications
| ISYNA1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| EC 5.5.1.4, hINO1, hIPS, INO1, INOS, inositol-3-phosphate synthase 1, IPSIPS 1, MI-1-P synthase, MIP synthase, Myo-inositol 1-phosphate synthase A1, Myo-inositol-1-phosphate synthase | |
| ISYNA1 | |
| IgG | |
| 61 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NPH2 | |
| 51477 | |
| Synthetic peptides corresponding to ISYNA1(myo-inositol 1-phosphate synthase A1) The peptide sequence was selected from the N terminal of ISYNA1. Peptide sequence LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title