missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Isocitrate Dehydrogenase 1/IDH1 Antibody (CL0219), Novus Biologicals™
Mouse Monoclonal Antibody
£240.00 - £375.00
Specifications
| Antigen | Isocitrate Dehydrogenase 1/IDH1 |
|---|---|
| Clone | CL0219 |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18619716
|
Novus Biologicals
NBP2-52882-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694008
|
Novus Biologicals
NBP2-52882 |
0.1 mL |
£375.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Isocitrate Dehydrogenase 1/IDH1 Monoclonal antibody specifically detects Isocitrate Dehydrogenase 1/IDH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDownSpecifications
| Isocitrate Dehydrogenase 1/IDH1 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| Cytosolic NADP-isocitrate dehydrogenase, EC 1.1.1.42, IDCD, IDH, IDP, IDPC, isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), soluble, NADP(+)-specific ICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, Oxalosuccinate decarboxylase, PICD | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| CL0219 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| Mouse | |
| Stem Cell Markers | |
| PBS (pH 7.2), 40% Glycerol | |
| 3417 | |
| IgG2a | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title