Isocitrate Dehydrogenase 1/IDH1 Antibody (CL0219), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-52882-25ul

Product Code. 18619716

Description

Isocitrate Dehydrogenase 1/IDH1 Monoclonal antibody specifically detects Isocitrate Dehydrogenase 1/IDH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: Isocitrate Dehydrogenase 1/IDH1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Clone: CL0219
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
• Gene Alias: Cytosolic NADP-isocitrate dehydrogenase, EC 1.1.1.42, IDCD, IDH, IDP, IDPC, isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), soluble, NADP(+)-specific ICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, Oxalosuccinate decarboxylase, PICD
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 3417
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG2a