missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ISG15 Activating Enzyme/UBE1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | ISG15 Activating Enzyme/UBE1L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18275674
|
Novus Biologicals
NBP2-55032 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646157
|
Novus Biologicals
NBP2-55032-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ISG15 Activating Enzyme/UBE1L Polyclonal specifically detects ISG15 Activating Enzyme/UBE1L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ISG15 Activating Enzyme/UBE1L | |
| Polyclonal | |
| Rabbit | |
| Human | |
| D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7 | |
| UBA7 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7318 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title