ISG15 Activating Enzyme/UBE1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55032-25ul

Product Code. 18646157

Description

ISG15 Activating Enzyme/UBE1L Polyclonal specifically detects ISG15 Activating Enzyme/UBE1L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ISG15 Activating Enzyme/UBE1L
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7318
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: UBA7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only