missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IRX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | IRX6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IRX6 Polyclonal specifically detects IRX6 in Human samples. It is validated for Western Blot.Specifications
| IRX6 | |
| Polyclonal | |
| Rabbit | |
| NP_077311 | |
| 79190 | |
| Synthetic peptide directed towards the N terminal of human IRX6The immunogen for this antibody is IRX6. Peptide sequence SFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| iroquois homeobox 6, Iroquois homeobox protein 6Homeodomain protein IRXB3, iroquois homeobox protein 7, iroquois-class homeodomain protein IRX-6, IRX-3, IRX7IRXB3 | |
| IRX6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title