missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IRX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79257
This item is not returnable.
View return policy
Description
IRX6 Polyclonal specifically detects IRX6 in Human samples. It is validated for Western Blot.
Specifications
| IRX6 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| iroquois homeobox 6, Iroquois homeobox protein 6Homeodomain protein IRXB3, iroquois homeobox protein 7, iroquois-class homeodomain protein IRX-6, IRX-3, IRX7IRXB3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 79190 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_077311 | |
| IRX6 | |
| Synthetic peptide directed towards the N terminal of human IRX6The immunogen for this antibody is IRX6. Peptide sequence SFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAP. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 85%; Canine: 85%; Guinea pig: 85%; Equine: 85%; Pig: 85%; Rat: 84%. | |
| Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction