missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Involucrin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33742
This item is not returnable.
View return policy
Description
Involucrin Polyclonal specifically detects Involucrin in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Involucrin | |
| Polyclonal | |
| Simple Western, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25 - 2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P07476 | |
| IVL | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ | |
| 0.1 mL | |
| Extracellular Matrix | |
| 3713 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| involucrin | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction