missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Involucrin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£248.00 - £460.00
Specifications
| Antigen | Involucrin |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18436191
|
Novus Biologicals
NBP2-33742-25ul |
25 μL |
£248.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18735593
|
Novus Biologicals
NBP2-33742 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Involucrin Polyclonal specifically detects Involucrin in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Involucrin | |
| Polyclonal | |
| Rabbit | |
| Extracellular Matrix | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| involucrin | |
| IVL | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P07476 | |
| 3713 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title