INCA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74090

Product Code. 18265893

Description

INCA Polyclonal specifically detects INCA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: INCA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: caspase recruitment domain family, member 17, caspase recruitment domain-containing protein 17, Caspase-1 inhibitor INCA, INCAInhibitory CARD, inhibitory caspase recruitment domain (CARD) protein, Inhibitory caspase recruitment domain protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 12 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 440068
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5XLA6
• Gene Symbols: CARD17
• Immunogen: Synthetic peptides corresponding to the middle region of CARD17. Immunizing peptide sequence MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.