missing translation for 'onlineSavingsMsg'
Learn More
Learn More
INCA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | INCA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
INCA Polyclonal specifically detects INCA in Human samples. It is validated for Western Blot.Specifications
| INCA | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| Q5XLA6 | |
| 440068 | |
| Synthetic peptides corresponding to the middle region of CARD17. Immunizing peptide sequence MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| caspase recruitment domain family, member 17, caspase recruitment domain-containing protein 17, Caspase-1 inhibitor INCA, INCAInhibitory CARD, inhibitory caspase recruitment domain (CARD) protein, Inhibitory caspase recruitment domain protein | |
| CARD17 | |
| IgG | |
| 12 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title