missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ILT6/CD85e/LILRA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ILT6/CD85e/LILRA3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ILT6/CD85e/LILRA3 Polyclonal specifically detects ILT6/CD85e/LILRA3 in Human samples. It is validated for Western Blot.Specifications
| ILT6/CD85e/LILRA3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_006856 | |
| 11026 | |
| The immunogen for this antibody is LILRA3 - C-terminal region. Peptide sequence AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CD85 antigen-like family member E, CD85e antigen, HM31, ILT-6, ILT6CD85e, Immunoglobulin-like transcript 6, leucocyte immunoglobulin-like receptor, Leukocyte immunoglobulin-like receptor 4, leukocyte immunoglobulin-like receptor A3, leukocyte immunoglobulin-like receptor subfamily A member 3, leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member3, LIR4CD85E, LIR-4HM43e3, Monocyte inhibitory receptor HM43/HM31 | |
| LILRA3 | |
| IgG | |
| 45 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title