ILT6/CD85e/LILRA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-98549

Product Code. 18094997

Description

ILT6/CD85e/LILRA3 Polyclonal specifically detects ILT6/CD85e/LILRA3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ILT6/CD85e/LILRA3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD85 antigen-like family member E, CD85e antigen, HM31, ILT-6, ILT6CD85e, Immunoglobulin-like transcript 6, leucocyte immunoglobulin-like receptor, Leukocyte immunoglobulin-like receptor 4, leukocyte immunoglobulin-like receptor A3, leukocyte immunoglobulin-like receptor subfamily A member 3, leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member3, LIR4CD85E, LIR-4HM43e3, Monocyte inhibitory receptor HM43/HM31
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_006856
• Gene Symbols: LILRA3
• Immunogen: The immunogen for this antibody is LILRA3 - C-terminal region. Peptide sequence AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11026
• Target Species: Human
• Isotype: IgG