missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ILT11/LILRA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | ILT11/LILRA5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ILT11/LILRA5 Polyclonal specifically detects ILT11/LILRA5 in Human samples. It is validated for Western Blot.Specifications
| ILT11/LILRA5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CD85, CD85 antigen-like family member F, CD85F, CD85f antigen, ILT-11, ILT11CD85f, Immunoglobulin-like transcript 11, leukocyte Ig-like receptor 9, Leukocyte immunoglobulin-like receptor 9, leukocyte immunoglobulin-like receptor subfamily A member 5, leukocyte immunoglobulin-like receptor subfamily A member 5 soluble, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LILRB7, LIR-9, LIR9immunoglobulin-like transcript 11 protein, member 7 | |
| The immunogen is a synthetic peptide directed towards the middle region of human ILT11/LILRA5 (NP_067073.1). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 353514 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title