missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ILT11/LILRA5 Polyclonal specifically detects ILT11/LILRA5 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | ILT11/LILRA5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CD85, CD85 antigen-like family member F, CD85F, CD85f antigen, ILT-11, ILT11CD85f, Immunoglobulin-like transcript 11, leukocyte Ig-like receptor 9, Leukocyte immunoglobulin-like receptor 9, leukocyte immunoglobulin-like receptor subfamily A member 5, leukocyte immunoglobulin-like receptor subfamily A member 5 soluble, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LILRB7, LIR-9, LIR9immunoglobulin-like transcript 11 protein, member 7 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ILT11/LILRA5 (NP_067073.1). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?