missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IGFALS/ALS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59164
This item is not returnable.
View return policy
Description
IGFALS/ALS Polyclonal specifically detects IGFALS/ALS in Human samples. It is validated for Western Blot.
Specifications
| IGFALS | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ALSinsulin-like growth factor binding protein complex acid labile chain, insulin-like growth factor binding protein, acid labile subunit, insulin-like growth factor-binding protein complex acid labile subunit | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 3483 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P35858 | |
| IGFALS | |
| Synthetic peptides corresponding to IGFALS(insulin-like growth factor binding protein, acid labile subunit) The peptide sequence was selected from the middle region of IGFALS. Peptide sequence DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 92%. | |
| Human, Mouse, Rat, Guinea Pig | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction