IGFALS/ALS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59164

Product Code. 18296221

Description

IGFALS/ALS Polyclonal specifically detects IGFALS/ALS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IGFALS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ALSinsulin-like growth factor binding protein complex acid labile chain, insulin-like growth factor binding protein, acid labile subunit, insulin-like growth factor-binding protein complex acid labile subunit
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3483
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P35858
• Gene Symbols: IGFALS
• Immunogen: Synthetic peptides corresponding to IGFALS(insulin-like growth factor binding protein, acid labile subunit) The peptide sequence was selected from the middle region of IGFALS. Peptide sequence DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Guinea Pig
• Isotype: IgG