missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IGF2BP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | IGF2BP3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IGF2BP3 Polyclonal specifically detects IGF2BP3 in Mouse samples. It is validated for Western Blot.Specifications
| IGF2BP3 | |
| Polyclonal | |
| Rabbit | |
| Q9CPN8 | |
| 10643 | |
| Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CT98, hKOC, IGF II mRNA binding protein 3, IGF2 mRNA-binding protein 3, IGF-II mRNA-binding protein 3, IMP-3KH domain-containing protein overexpressed in cancer, IMP3VICKZ family member 3, insulin-like growth factor 2 mRNA binding protein 3, insulin-like growth factor 2 mRNA-binding protein 3, KH domain containing protein overexpressed in cancer, KOC1DKFZp686F1078, VICKZ3cancer/testis antigen 98 | |
| IGF2BP3 | |
| IgG | |
| 63 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title