IGF2BP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-68981

Product Code. 18285105

Description

IGF2BP3 Polyclonal specifically detects IGF2BP3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: IGF2BP3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CT98, hKOC, IGF II mRNA binding protein 3, IGF2 mRNA-binding protein 3, IGF-II mRNA-binding protein 3, IMP-3KH domain-containing protein overexpressed in cancer, IMP3VICKZ family member 3, insulin-like growth factor 2 mRNA binding protein 3, insulin-like growth factor 2 mRNA-binding protein 3, KH domain containing protein overexpressed in cancer, KOC1DKFZp686F1078, VICKZ3cancer/testis antigen 98
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 92%; Rabbit: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9CPN8
• Gene Symbols: IGF2BP3
• Immunogen: Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10643
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.