missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IFT122 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | IFT122 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IFT122 Polyclonal specifically detects IFT122 in Human samples. It is validated for Western Blot.Specifications
| IFT122 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Bovine | |
| intraflagellar transport 122 homolog (Chlamydomonas), intraflagellar transport protein 122 homolog, SPGWD repeat-containing protein 140, WD repeat domain 10, WD repeat-containing protein 10, WDR10WDR10p, WDR140CED | |
| IFT122 | |
| IgG | |
| 129 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9HBG6 | |
| 55764 | |
| Synthetic peptides corresponding to IFT122(intraflagellar transport 122 homolog (Chlamydomonas)) The peptide sequence was selected from the C terminal of IFT122. Peptide sequence QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title