IFT122 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54842

Product Code. 18297054

Description

IFT122 Polyclonal specifically detects IFT122 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IFT122
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: intraflagellar transport 122 homolog (Chlamydomonas), intraflagellar transport protein 122 homolog, SPGWD repeat-containing protein 140, WD repeat domain 10, WD repeat-containing protein 10, WDR10WDR10p, WDR140CED
• Host Species: Rabbit
• Molecular Weight of Antigen: 129 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9HBG6
• Gene Symbols: IFT122
• Immunogen: Synthetic peptides corresponding to IFT122(intraflagellar transport 122 homolog (Chlamydomonas)) The peptide sequence was selected from the C terminal of IFT122. Peptide sequence QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55764
• Target Species: Human, Mouse, Bovine
• Isotype: IgG