missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IFN-gamma R2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | IFN-gamma R2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IFN-gamma R2 Polyclonal specifically detects IFN-gamma R2 in Human samples. It is validated for Western Blot.Specifications
| IFN-gamma R2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AF-1interferon-gamma receptor beta chain precursor10IFNGT1Interferon gamma receptor accessory factor 1, IFGR2, IFN-gamma receptor 2, IFN-gamma-R2, interferon gamma receptor 2, interferon gamma receptor 2 (interferon gamma transducer 1), interferon gamma receptor accessory factor-1, interferon gamma receptor beta chain, Interferon gamma transducer 1 | |
| IFNGR2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P38484 | |
| 3460 | |
| Synthetic peptides corresponding to IFNGR2(interferon gamma receptor 2 (interferon gamma transducer 1)) The peptide sequence was selected from the middle region of IFNGR2. Peptide sequence WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title