IFN-gamma R2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59795

Product Code. 18269732

Description

IFN-gamma R2 Polyclonal specifically detects IFN-gamma R2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IFN-gamma R2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AF-1interferon-gamma receptor beta chain precursor10IFNGT1Interferon gamma receptor accessory factor 1, IFGR2, IFN-gamma receptor 2, IFN-gamma-R2, interferon gamma receptor 2, interferon gamma receptor 2 (interferon gamma transducer 1), interferon gamma receptor accessory factor-1, interferon gamma receptor beta chain, Interferon gamma transducer 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3460
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P38484
• Gene Symbols: IFNGR2
• Immunogen: Synthetic peptides corresponding to IFNGR2(interferon gamma receptor 2 (interferon gamma transducer 1)) The peptide sequence was selected from the middle region of IFNGR2. Peptide sequence WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG