missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ICT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ICT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ICT Polyclonal specifically detects ICT in Human samples. It is validated for Western Blot.Specifications
| ICT | |
| Polyclonal | |
| Rabbit | |
| Q14197 | |
| 3396 | |
| Synthetic peptides corresponding to ICT1(immature colon carcinoma transcript 1) The peptide sequence was selected from the middle region of ICT1. Peptide sequence AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Digestion substraction 1, DS-1DS1, EC 3.1.1.29, immature colon carcinoma transcript 1, Immature colon carcinoma transcript 1 protein, peptidyl-tRNA hydrolase ICT1, mitochondrial | |
| ICT1 | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title