ICT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55014

Product Code. 18278321

Description

ICT Polyclonal specifically detects ICT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ICT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Digestion substraction 1, DS-1DS1, EC 3.1.1.29, immature colon carcinoma transcript 1, Immature colon carcinoma transcript 1 protein, peptidyl-tRNA hydrolase ICT1, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 3396
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14197
• Gene Symbols: ICT1
• Immunogen: Synthetic peptides corresponding to ICT1(immature colon carcinoma transcript 1) The peptide sequence was selected from the middle region of ICT1. Peptide sequence AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.