missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ICAP-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £484.00
Specifications
| Antigen | ICAP-1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18296282
|
Novus Biologicals
NBP2-57261 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646058
|
Novus Biologicals
NBP2-57261-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ICAP-1 Polyclonal specifically detects ICAP-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| ICAP-1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9270 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| bodenin, DKFZp686K08158, ICAP-1, ICAP-1alpha, ICAP-1B, ICAP1ICAP1AICAP1BICAP-1A, integrin beta 1 binding protein 1, integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1, integrin cytoplasmic domain-associated protein 1-alpha, integrin cytoplasmic domain-associated protein 1-beta | |
| ITGB1BP1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title