ICAP-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque:  Novus Biologicals NBP2-57261-25ul

Code produit. 18646058

Description

ICAP-1 Polyclonal specifically detects ICAP-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Spécification

• Antigen: ICAP-1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: bodenin, DKFZp686K08158, ICAP-1, ICAP-1alpha, ICAP-1B, ICAP1ICAP1AICAP1BICAP-1A, integrin beta 1 binding protein 1, integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1, integrin cytoplasmic domain-associated protein 1-alpha, integrin cytoplasmic domain-associated protein 1-beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ITGB1BP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK
• Quantity: 25 μL
• Research Discipline: Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 9270
• Target Species: Human
• Form: Purified

For Research Use Only