missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ICAP-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57261-25ul
This item is not returnable.
View return policy
Description
ICAP-1 Polyclonal specifically detects ICAP-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| ICAP-1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| bodenin, DKFZp686K08158, ICAP-1, ICAP-1alpha, ICAP-1B, ICAP1ICAP1AICAP1BICAP-1A, integrin beta 1 binding protein 1, integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1, integrin cytoplasmic domain-associated protein 1-alpha, integrin cytoplasmic domain-associated protein 1-beta | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ITGB1BP1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK | |
| 25 μL | |
| Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers | |
| 9270 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction