missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HYAL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | HYAL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HYAL3 Polyclonal specifically detects HYAL3 in Human samples. It is validated for Western Blot.Specifications
| HYAL3 | |
| Polyclonal | |
| Rabbit | |
| NP_003540 | |
| 8372 | |
| The immunogen for this antibody is HYAL3. Peptide sequence RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.2.1.35, Hyal-3, hyaluronidase-3, hyaluronoglucosaminidase 3, Hyaluronoglucosaminidase-3, LUCA14, LuCa-3, LUCA3LUCA-3, Lung carcinoma protein 3, Minna14 | |
| HYAL3 | |
| IgG | |
| 46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title