HYAL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79911

Product Code. 18248577

Description

HYAL3 Polyclonal specifically detects HYAL3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HYAL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.2.1.35, Hyal-3, hyaluronidase-3, hyaluronoglucosaminidase 3, Hyaluronoglucosaminidase-3, LUCA14, LuCa-3, LUCA3LUCA-3, Lung carcinoma protein 3, Minna14
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 86%; Guinea pig: 86%; Rabbit: 79%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003540
• Gene Symbols: HYAL3
• Immunogen: The immunogen for this antibody is HYAL3. Peptide sequence RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8372
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.