missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KLF10 Partial ORF (AAH11538.1, 111 a.a. - 210 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

£275.34 - £418.72

Specifications

Name KLF10 (Human) Recombinant Protein (Q02)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.63kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16094865
View Documents
Abnova™
H00007071-Q02.10UG
10 ug
£275.34
10µg
View alternative products
Save Up to 
»
Estimated Shipment
12-11-2020
Please to purchase this item. Need a web account? Register with us today!
16004875
View Documents
Abnova™
H00007071-Q02.25UG
25 ug
£418.72
25µg
View alternative products
Save Up to 
»
Estimated Shipment
12-11-2020
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Sequence: LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
Specifications

Specifications

KLF10 (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
SDS