missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSPC111 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HSPC111 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HSPC111 Polyclonal specifically detects HSPC111 in Human samples. It is validated for Western Blot.Specifications
| HSPC111 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast) | |
| NOP16 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Y3C1 | |
| 51491 | |
| Synthetic peptides corresponding to HSPC111(hypothetical protein HSPC111) The peptide sequence was selected from the middle region of HSPC111. Peptide sequence RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title