missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSFY1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | HSFY1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
HSFY1 Polyclonal specifically detects HSFY1 in Human samples. It is validated for Western Blot.Specifications
| HSFY1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ25453, Heat shock transcription factor 2-like protein, heat shock transcription factor, Y linked 2, heat shock transcription factor, Y-linked, HSF2L, HSF2-like, HSFY, HSFY1 | |
| HSFY1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q96LI6 | |
| 86614 | |
| Synthetic peptide directed towards the N terminal of human HSFY1 (NP_149099). Peptide sequence SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI. | |
| Primary | |
| 45 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title