missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSF5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | HSF5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HSF5 Polyclonal specifically detects HSF5 in Human samples. It is validated for Western Blot.Specifications
| HSF5 | |
| Polyclonal | |
| Rabbit | |
| NP_001073908 | |
| 124535 | |
| Synthetic peptide directed towards the middle region of human HSF5. Peptide sequence SKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKEEELK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ40311, heat shock factor protein 5, heat shock transcription factor 5, heat shock transcription factor family member 5, HSF 5, HSTF 5, HSTF5, MGC134827 | |
| HSF5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title