HSF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91313

Product Code. 18313631

Description

HSF5 Polyclonal specifically detects HSF5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HSF5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ40311, heat shock factor protein 5, heat shock transcription factor 5, heat shock transcription factor family member 5, HSF 5, HSTF 5, HSTF5, MGC134827
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 124535
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001073908
• Gene Symbols: HSF5
• Immunogen: Synthetic peptide directed towards the middle region of human HSF5. Peptide sequence SKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKEEELK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Chicken: 90%; Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG