missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | HOXD8 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30233011
|
Novus Biologicals
NBP3-35703-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228785
|
Novus Biologicals
NBP3-35703-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HOXD8 Polyclonal antibody specifically detects HOXD8 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| HOXD8 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| homeo box 4E, homeo box D8, homeobox D8, homeobox protein 5.4, Homeobox protein Hox-4E, Homeobox protein Hox-5.4, homeobox protein Hox-D8, HOX4, HOX4EHox-4.5, HOX5.4 | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HOXD8 (NP_001186675.1).,, Sequence:, RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 3234 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title