HOXD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35703-20ul

Product Code. 30228785

Description

HOXD8 Polyclonal antibody specifically detects HOXD8 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: HOXD8
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: homeo box 4E, homeo box D8, homeobox D8, homeobox protein 5.4, Homeobox protein Hox-4E, Homeobox protein Hox-5.4, homeobox protein Hox-D8, HOX4, HOX4EHox-4.5, HOX5.4
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HOXD8 (NP_001186675.1).,, Sequence:, RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3234
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG