missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXC6 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33439-100ul
This item is not returnable.
View return policy
Description
HOXC6 Monoclonal antibody specifically detects HOXC6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| HOXC6 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| CP25, HHO.C8, homeo box 3C, homeo box C6, homeo box C8 protein, homeobox C6, Homeobox protein CP25, Homeobox protein HHO.C8, Homeobox protein Hox-3C, homeobox protein Hox-C6, HOX3CHOX3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HOXC6 (NP_004494.1).,, Sequence:, MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSI | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 3223 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction