missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXB6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35324-100ul
This item is not returnable.
View return policy
Description
HOXB6 Polyclonal antibody specifically detects HOXB6 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| HOXB6 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| homeo box 2B, homeo box B6, homeobox B6, Homeobox protein Hox-2.2, Homeobox protein Hox-2B, homeobox protein Hox-B6, Homeobox protein Hu-2, HOX2, Hox-2.2, HOX2BHU-2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human HOXB6 (NP_061825.2).,, Sequence:, SGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQ | |
| 100 μL | |
| Primary | |
| Human, Mouse | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 3216 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction