missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Homez Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | Homez |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Homez Polyclonal specifically detects Homez in Mouse samples. It is validated for Western Blot.Specifications
| Homez | |
| Polyclonal | |
| Purified | |
| RUO | |
| homeobox and leucine zipper encoding, homeobox and leucine zipper protein Homez, KIAA1443Homeodomain leucine zipper-containing factor | |
| HOMEZ | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_898997 | |
| 57594 | |
| Synthetic peptide directed towards the N terminal of mouse HOMEZ. Peptide sequence LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title