missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIV-1 Gag p24 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£150.00 - £417.00
Specifications
| Antigen | HIV-1 Gag p24 |
|---|---|
| Concentration | 1 mg/mL |
| Applications | Western Blot, ELISA |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18662297
|
Novus Biologicals
NBP2-41214-0.025mg |
0.025 mg |
£150.00
0.03mg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18118547
|
Novus Biologicals
NBP2-41214 |
0.1 mg |
£417.00
0.10mg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.Specifications
| HIV-1 Gag p24 | |
| Western Blot, ELISA | |
| Unconjugated | |
| RUO | |
| PBS with 0.02% Sodium Azide | |
| 155030 | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| Primary | |
| This antibody detects a 24 kDa recombinant protein. |
| 1 mg/mL | |
| Polyclonal | |
| Rabbit | |
| Virus | |
| Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24 | |
| gag | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title