HIV-1 Gag p24 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-41214-0.025mg

Product Code. 18662297

Description

HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.

Specifications

• Antigen: HIV-1 Gag p24
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS with 0.02% Sodium Azide
• Gene Symbols: gag
• Immunogen: Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 155030
• Target Species: Virus
• Isotype: IgG

• Applications: Western Blot, ELISA
• Concentration: 1 mg/mL
• Dilution: Western Blot 0.5 - 1 μg/mL, ELISA
• Gene Alias: Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 0.025 mg
• Primary or Secondary: Primary
• Test Specificity: This antibody detects a 24 kDa recombinant protein.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.