missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histone H2AY/macroH2A.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Histone H2AY/macroH2A.1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot.Specifications
| Histone H2AY/macroH2A.1 | |
| Polyclonal | |
| Rabbit | |
| O75367 | |
| 9555 | |
| Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1 | |
| H2AFY | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title