missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HISPPD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HISPPD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HISPPD1 Polyclonal specifically detects HISPPD1 in Human samples. It is validated for Western Blot.Specifications
| HISPPD1 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| diphosphoinositol pentakisphosphate kinase 2FLJ21506, EC 2.7.4.21, EC 2.7.4.24, HISPPD1histidine acid phosphatase domain containing 1, Histidine acid phosphatase domain-containing protein 1, hsVIP2, inositol heptaphosphate kinase 2, inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2, InsP6 and PP-IP5 kinase 2, KIAA0433FLJ23463, VIP1 homolog 2, VIP2IP7K2 | |
| PPIP5K2 | |
| IgG | |
| 138 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O43314 | |
| 23262 | |
| Synthetic peptides corresponding to HISPPD1(histidine acid phosphatase domain containing 1) The peptide sequence was selected from the middle region of HISPPD1. Peptide sequence SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title