HISPPD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54642

Product Code. 18262271

Description

HISPPD1 Polyclonal specifically detects HISPPD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HISPPD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: diphosphoinositol pentakisphosphate kinase 2FLJ21506, EC 2.7.4.21, EC 2.7.4.24, HISPPD1histidine acid phosphatase domain containing 1, Histidine acid phosphatase domain-containing protein 1, hsVIP2, inositol heptaphosphate kinase 2, inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2, InsP6 and PP-IP5 kinase 2, KIAA0433FLJ23463, VIP1 homolog 2, VIP2IP7K2
• Host Species: Rabbit
• Molecular Weight of Antigen: 138 kDa
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 23262
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43314
• Gene Symbols: PPIP5K2
• Immunogen: Synthetic peptides corresponding to HISPPD1(histidine acid phosphatase domain containing 1) The peptide sequence was selected from the middle region of HISPPD1. Peptide sequence SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.