missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HEY2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | HEY2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18251463
|
Novus Biologicals
NBP2-57809 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18641387
|
Novus Biologicals
NBP2-57809-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HEY2 Polyclonal specifically detects HEY2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| HEY2 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| BHLHB32, bHLHb32HES-related repressor protein 2, cardiovascular basic helix-loop-helix factor 1, Cardiovascular helix-loop-helix factor 1, CHF1, Class B basic helix-loop-helix protein 32, GRLGRIDLOCK, Hairy and enhancer of split-related protein 2, hairy/enhancer-of-split related with YRPW motif 2, hairy/enhancer-of-split related with YRPW motif protein 2, Hairy-related transcription factor 2, hCHF1, HERP, HERP1hHRT2, HESR2, HESR-2, HES-related repressor protein 1, HRT2, HRT-2, MGC10720, Protein gridlock homolog | |
| HEY2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 23493 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title