HEY2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57809

Product Code. 18251463

Description

HEY2 Polyclonal specifically detects HEY2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HEY2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BHLHB32, bHLHb32HES-related repressor protein 2, cardiovascular basic helix-loop-helix factor 1, Cardiovascular helix-loop-helix factor 1, CHF1, Class B basic helix-loop-helix protein 32, GRLGRIDLOCK, Hairy and enhancer of split-related protein 2, hairy/enhancer-of-split related with YRPW motif 2, hairy/enhancer-of-split related with YRPW motif protein 2, Hairy-related transcription factor 2, hCHF1, HERP, HERP1hHRT2, HESR2, HESR-2, HES-related repressor protein 1, HRT2, HRT-2, MGC10720, Protein gridlock homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: HEY2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 23493
• Target Species: Human
• Isotype: IgG

For Research Use Only