missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HERC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£415.00
Specifications
| Antigen | HERC6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HERC6 Polyclonal specifically detects HERC6 in Human samples. It is validated for Western Blot.Specifications
| HERC6 | |
| Polyclonal | |
| Rabbit | |
| Q8IVU3 | |
| 55008 | |
| Synthetic peptides corresponding to HERC6(hect domain and RLD 6) Antibody(against the N terminal of HERC6. Peptide sequence LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 6.3.2, EC 6.3.2.-, FLJ20637, HECT domain and RCC1-like domain-containing protein 6, hect domain and RLD 6, potential ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC6 | |
| HERC6 | |
| IgG | |
| 115 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title