HERC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55025

Product Code. 18274994

Description

HERC6 Polyclonal specifically detects HERC6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HERC6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2, EC 6.3.2.-, FLJ20637, HECT domain and RCC1-like domain-containing protein 6, hect domain and RLD 6, potential ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC6
• Host Species: Rabbit
• Molecular Weight of Antigen: 115 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IVU3
• Gene Symbols: HERC6
• Immunogen: Synthetic peptides corresponding to HERC6(hect domain and RLD 6) Antibody(against the N terminal of HERC6. Peptide sequence LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55008
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG