missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HEMK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HEMK2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HEMK2 Polyclonal specifically detects HEMK2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| HEMK2 | |
| Polyclonal | |
| Rabbit | |
| Q96F73 | |
| 29104 | |
| Synthetic peptides corresponding to N6AMT1(N-6 adenine-specific DNA methyltransferase 1 (putative)) The peptide sequence was selected from the N terminal of N6AMT1. Peptide sequence MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, M.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-methyltransferase, PRED28 | |
| N6AMT1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title